PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G03660.1
Common NameT12J13.6, WOX11
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WOX
Protein Properties Length: 268aa    MW: 29419.5 Da    PI: 6.999
Description WUSCHEL related homeobox 11
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G03660.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox49.66.6e-163191257
                 T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                 r+R+++++eq+ +Le+ F++   +p +ee  ++ k l     + +++V++WFqNrR + ++
  AT3G03660.1 31 RSRWSPKPEQILILESIFHSgMVNPPKEETVRIRKMLekfgAVGDANVFYWFQNRRSRSRR 91
                 89*****************99*************************************997 PP

2Wus_type_Homeobox106.81.3e-343093265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +r+RW+P+peQi iLe++++sG+++P+kee+ ri+++Le++G+++d+NVfyWFQNr++R+r++q
        AT3G03660.1 30 VRSRWSPKPEQILILESIFHSGMVNPPKEETVRIRKMLEKFGAVGDANVFYWFQNRRSRSRRRQ 93
                       589***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.4E-9992IPR009057Homeodomain-like
SuperFamilySSF466891.07E-142398IPR009057Homeodomain-like
PROSITE profilePS5007111.6452792IPR001356Homeobox domain
SMARTSM003893.5E-72996IPR001356Homeobox domain
PfamPF000461.1E-133191IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0048830Biological Processadventitious root development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MDQEQTPHSP TRHSRSPPSS ASGSTSAEPV RSRWSPKPEQ ILILESIFHS GMVNPPKEET  60
VRIRKMLEKF GAVGDANVFY WFQNRRSRSR RRQRQLQAAA AAADATTNTC DQTMMVSNSL  120
PHHSGSDLGF GGCSTSSNYL FASSSSSYGG GCDNQSNSGM ENLLTMSGQM SYHEATHHHY  180
QNHSSNVTSI LCPSDQNSNF QYQQGAITVF INGVPTEVTR GGIDMKATFG EDLVLVHSSG  240
VPLPTDEFGF LMHSLQHGEA YFLVPRQT
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.409420.0seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible259223_at0.0
Expression AtlasAT3G03660-
AtGenExpressAT3G03660-
ATTED-IIAT3G03660-
Functional Description ? help Back to Top
Source Description
TAIREncodes a WUSCHEL-related homeobox gene family member with 65 amino acids in its homeodomain. Proteins in this family contain a sequence of eight residues (TLPLFPMH) downstream of the homeodomain called the WUS box.
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. WOX11 directly responds to a wounding-induced auxin maximum in and surrounding the procambium and acts redundantly with its homolog WOX12 to upregulate LATERAL ORGAN BOUNDARIES DOMAIN16 (LBD16) and LBD29
    [PMID: 24642937]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00330DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G03660.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G03660
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2514020.0AY251402.1 Arabidopsis thaliana WOX11 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_187016.20.0WUSCHEL related homeobox 11
SwissprotQ6X7J30.0WOX11_ARATH; WUSCHEL-related homeobox 11
TrEMBLB3H5D31e-175B3H5D3_ARATH; WUSCHEL related homeobox 11
STRINGAT3G03660.21e-175(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. R
    Rapid identification of Arabidopsis insertion mutants by non-radioactive detection of T-DNA tagged genes.
    Plant J., 2002. 32(2): p. 243-53
    [PMID:12383089]
  3. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  4. Haecker A, et al.
    Expression dynamics of WOX genes mark cell fate decisions during early embryonic patterning in Arabidopsis thaliana.
    Development, 2004. 131(3): p. 657-68
    [PMID:14711878]
  5. Wagner R,Pfannschmidt T
    Eukaryotic transcription factors in plastids--Bioinformatic assessment and implications for the evolution of gene expression machineries in plants.
    Gene, 2006. 381: p. 62-70
    [PMID:16934950]
  6. Wu X,Chory J,Weigel D
    Combinations of WOX activities regulate tissue proliferation during Arabidopsis embryonic development.
    Dev. Biol., 2007. 309(2): p. 306-16
    [PMID:17706632]
  7. Hirakawa Y,Kondo Y,Fukuda H
    TDIF peptide signaling regulates vascular stem cell proliferation via the WOX4 homeobox gene in Arabidopsis.
    Plant Cell, 2010. 22(8): p. 2618-29
    [PMID:20729381]
  8. Zhang X,Zong J,Liu J,Yin J,Zhang D
    Genome-wide analysis of WOX gene family in rice, sorghum, maize, Arabidopsis and poplar.
    J Integr Plant Biol, 2010. 52(11): p. 1016-26
    [PMID:20977659]
  9. Liu J, et al.
    WOX11 and 12 are involved in the first-step cell fate transition during de novo root organogenesis in Arabidopsis.
    Plant Cell, 2014. 26(3): p. 1081-93
    [PMID:24642937]